Description
The kit takes out from the refrigeration should be balanced 15-30 minutes in the room temperature, if the coated ELISA plates have not been used up after opening, the plate should be stored in sealed bag.
Washing buffer will Crystallization separation, it can be heated the water helps dissolve when dilution. Washing does not affect the result.
Pipette sample with pipettors each step, and proofread its accuracy frequently, avoids the experimental error. Pipette sample within 5 min, if the number of sample is much, recommend using multichannel pipettor.
If the testing material content is excessively high (The sample OD is higher than the first standard well)?please dilute sample (n-fold).
Adhesive Strip only limits the disposable use to avoid cross-contamination.
The substrate should be preserved evade the light.
Please refer to use instruction strictly. The test result determination must take the microtiter plate reader as a standard.
All samples, washing buffer and each kind of reject should refer to infective material process.
Do not mix reagents with those from other lots.
Reactivity : Human
Method type : Sandwich ELISA
Minimum Detection Limit :
Detection Range :
Application : ELISA
Purpose : For the quantitative determination of target substances concentrations.
Research Area : Immunology->Innate Immunity->Complement->Alternative Pathway, Immunology->Innate Immunity->Complement->Other
Sample Type : serum, plasma, Urine, tissue samples, cell culture supernates
Plate : Pre-coated,Strips (12 x 8)
Restrictions : For Research Use only
Storage : 2 °C - 8 °C
Storage Comment : Store at 4°C for 6 months, at -20°C for 12 months. Avoid multiple freeze-thaw cycles
Expiry Date : 12 months
Size : 96T
Uniprot No. :P45985
Abbreviation :
MAAPSPSGGGGSGGGSGSGTPGPVGSPAPGHPAVSSMQGKRKALKLNFANPPFKSTARFT
LNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNKMV
HKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMEL
MSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRS
GNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYEL
ATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYKE
LLKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD
Availability : 3-5 working days
Target Details :Dual specificity protein kinase which acts as an essential component of the MAP kinase signal transduction pathway. Essential component of the stress-activated protein kinase/c-Jun N-terminal kinase (SAP/JNK) signaling pathway. With MAP2K7/MKK7, is the one of the only known kinase to directly activate the stress-activated protein kinase/c-Jun N-terminal kinases MAPK8/JNK1, MAPK9/JNK2 and MAPK10/JNK3. MAP2K4/MKK4 and MAP2K7/MKK7 both activate the JNKs by phosphorylation, but they differ in their preference for the phosphorylation site in the Thr-Pro-Tyr motif. MAP2K4 shows preference for phosphorylation of the Tyr residue and MAP2K7/MKK7 for the Thr residue. The phosphorylation of the Thr residue by MAP2K7/MKK7 seems to be the prerequisite for JNK activation at least in response to proinflammatory cytokines, while other stimuli activate both MAP2K4/MKK4 and MAP2K7/MKK7 which synergistically phosphorylate JNKs. MAP2K4 is required for maintaining peripheral lymphoid homeostasis. The MKK/JNK signaling pathway is also involved in mitochondrial death signaling pathway, including the release cytochrome c, leading to apoptosis. Whereas MAP2K7/MKK7 exclusively activates JNKs, MAP2K4/MKK4 additionally activates the p38 MAPKs MAPK11, MAPK12, MAPK13 and MAPK14.
Precision : Intra-assay Precision (Precision within an assay) CV%<15% Three samples of known concentration were tested twenty times on one plate to assess. Inter-assay Precision (Precision between assays) CV%<15% Three samples of known concentration were tested in twenty assays to assess.
Linearity : To assess the linearity of the assay, samples were spiked with hig3h concentrations of rat ADP in various matrices and diluted with the Sample Diluent to produce samples with values within the dynamic range of the assay.
Recovery :
Typical Data : These standard curves are provided for demonstration only. A standard curve should be generated for each set of samples assayed. ng/ml OD1 OD2 Average 1000 0.088 0.090 0.089 500 0.135 0.142 0.139 250 0.227 0.237 0.232 125 0.324 0.341 0.333 62.5 0.583 0.598 0.591 31.25 0.847 0.864 0.856 15.62 1.228 1.235 1.232 0 2.155 2.199 2.177
