Enter your keyword

0.1%

Original price was: $971.85.Current price is: $971.01.

Reagent Quantity Microelisa Stripplate 12well×8strips Standard: 90?mol/L 1×0.5ml Standard Diluent 1×1.5ml HRP-Conjugate Reagent 1×6ml Sample Diluent 1×6ml Chromogen Solution A 1×6ml Chromogen Solution B 1×6ml Stop Solution 1×6ml Wash Solution 1×20ml×30 fold User manual 1 Adhesive Strip 105

Compare
D6616. In stock N/A , . , , , , .

Description

The kit takes out from the refrigeration should be balanced 15-30 minutes in the room temperature, if the coated ELISA plates have not been used up after opening, the plate should be stored in sealed bag.
Washing buffer will Crystallization separation, it can be heated the water helps dissolve when dilution. Washing does not affect the result.
Pipette sample with pipettors each step, and proofread its accuracy frequently, avoids the experimental error. Pipette sample within 5 min, if the number of sample is much, recommend using multichannel pipettor.
If the testing material content is excessively high (The sample OD is higher than the first standard well)?please dilute sample (n-fold).
Adhesive Strip only limits the disposable use to avoid cross-contamination.
The substrate should be preserved evade the light.
Please refer to use instruction strictly. The test result determination must take the microtiter plate reader as a standard.
All samples, washing buffer and each kind of reject should refer to infective material process.
Do not mix reagents with those from other lots.

Reactivity : Human

Method type : Sandwich ELISA

Minimum Detection Limit :

Detection Range :

Application : ELISA

Purpose : For the quantitative determination of target substances concentrations.

Research Area : Immunology->Innate Immunity->Complement->Alternative Pathway, Immunology->Innate Immunity->Complement->Other

Sample Type : serum, plasma, Urine, tissue samples, cell culture supernates

Plate : Pre-coated,Strips (12 x 8)

Restrictions : For Research Use only

Storage : 2 °C - 8 °C

Storage Comment : Store at 4°C for 6 months, at -20°C for 12 months. Avoid multiple freeze-thaw cycles

Expiry Date : 12 months

Size : 96T

Uniprot No. :Q6UXV0

Abbreviation :Recombinant fragment corresponding to Human GFRAL aa 19-351.
Sequence:                                                    SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNL SIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLT TRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQ AAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPP TCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLT CSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFN YPTLSNVKGMALYTRKHANKITLTGFHSPFNGE

Availability : 3-5 working days

Target Details :Belongs to the GDNFR family.

Precision : Intra-assay Precision (Precision within an assay) CV%<15%   Three samples of known concentration were tested twenty times on one plate to assess.   Inter-assay Precision (Precision between assays) CV%<15%   Three samples of known concentration were tested in twenty assays to assess.

Linearity : To assess the linearity of the assay, samples were spiked with hig3h concentrations of rat ADP in various matrices and diluted with the Sample Diluent to produce samples with values within the dynamic range of the assay.

Recovery :

Typical Data : These standard curves are provided for demonstration only. A standard curve should be generated for each set of samples assayed. ng/ml OD1 OD2 Average     1000 0.088 0.090 0.089     500 0.135 0.142 0.139     250 0.227 0.237 0.232     125 0.324 0.341 0.333     62.5 0.583 0.598 0.591     31.25 0.847 0.864 0.856     15.62 1.228 1.235 1.232     0 2.155 2.199 2.177

https://www.glorybios.com/product/28194/