Description
The kit takes out from the refrigeration should be balanced 15-30 minutes in the room temperature, if the coated ELISA plates have not been used up after opening, the plate should be stored in sealed bag.
Washing buffer will Crystallization separation, it can be heated the water helps dissolve when dilution. Washing does not affect the result.
Pipette sample with pipettors each step, and proofread its accuracy frequently, avoids the experimental error. Pipette sample within 5 min, if the number of sample is much, recommend using multichannel pipettor.
If the testing material content is excessively high (The sample OD is higher than the first standard well)?please dilute sample (n-fold).
Adhesive Strip only limits the disposable use to avoid cross-contamination.
The substrate should be preserved evade the light.
Please refer to use instruction strictly. The test result determination must take the microtiter plate reader as a standard.
All samples, washing buffer and each kind of reject should refer to infective material process.
Do not mix reagents with those from other lots.
Reactivity : Human
Method type : Sandwich ELISA
Minimum Detection Limit :
Detection Range :
Application : ELISA
Purpose : For the quantitative determination of target substances concentrations.
Research Area : Tags & Cell Markers->Cell Type Markers->Tumor Associated, Signal Transduction->Cytoskeleton / ECM->Cell Adhesion->Cell Adhesion Molecules->Vascular, Signal Transduction->Cytoskeleton / ECM->Cell Adhesion->Cell Adhesion Molecules->Endothelial, Neuroscience->Neurology process->Neural Signal Transduction, Stem Cells->Mesenchymal Stem Cells->Surface Molecules, Cancer->Invasion/microenvironment->ECM->Cell adhesion->Other, Cardiovascular->Atherosclerosis->Vascular Inflammation->Leukocyte recruitment->Cell adhesion molecules, Kits/ Lysates/ Other->Kits->ELISA Kits->ELISA Kits->Adhesion molecules ELISA kits, Kits/ Lysates/ Other->Kits->ELISA Kits->ELISA Kits->Atherosclerotic proteins ELISA kits, Cardiovascular->Angiogenesis->Endothelial Cell Markers
Sample Type : serum, plasma, Urine, tissue samples, cell culture supernates
Plate : Pre-coated,Strips (12 x 8)
Restrictions : For Research Use only
Storage : 2 °C - 8 °C
Storage Comment : Store at 4°C for 6 months, at -20°C for 12 months. Avoid multiple freeze-thaw cycles
Expiry Date : 12 months
Size : 96T
Uniprot No. :P04150
Abbreviation :
MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRR LLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLK LLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGN VKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGN SNEDCKPLILPDTKPKIKDNGDLVLSSPSNVTLPQVKTEKEDFIELCTPGVIKQEKLGTV YCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVG SENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKL CLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRK CLQAGMNLEARKTKKKIKGIQQATTGVSQETSENPGNKTIVPATLPQLTPTLVSLLEVIE PEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSW MFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSY EEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTK LLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK
Availability : 3-5 working days
Target Details :Receptor for glucocorticoids (GC) (PubMed:27120390). Has a dual mode of action: as a transcription factor that binds to glucocorticoid response elements (GRE), both for nuclear and mitochondrial DNA, and as a modulator of other transcription factors. Affects inflammatory responses, cellular proliferation and differentiation in target tissues. Involved in chromatin remodeling (PubMed:9590696). Plays a role in rapid mRNA degradation by binding to the 5' UTR of target mRNAs and interacting with PNRC2 in a ligand-dependent manner which recruits the RNA helicase UPF1 and the mRNA-decapping enzyme DCP1A, leading to RNA decay (PubMed:25775514). Could act as a coactivator for STAT5-dependent transcription upon growth hormone (GH) stimulation and could reveal an essential role of hepatic GR in the control of body growth (By similarity).Isoform Alpha: Has transcriptional activation and repression activity (PubMed:15866175, PubMed:19248771, PubMed:20484466, PubMed:23820903, PubMed:11435610, PubMed:15769988, PubMed:17635946, PubMed:19141540, PubMed:21664385). Mediates glucocorticoid-induced apoptosis (PubMed:23303127). Promotes accurate chromosome segregation during mitosis (PubMed:25847991). May act as a tumor suppressor (PubMed:25847991). May play a negative role in adipogenesis through the regulation of lipolytic and antilipogenic gene expression (By similarity).Isoform Beta: Acts as a dominant negative inhibitor of isoform Alpha (PubMed:7769088, PubMed:8621628, PubMed:20484466). Has intrinsic transcriptional activity independent of isoform Alpha when both isoforms are coexpressed (PubMed:19248771, PubMed:26711253). Loses this transcription modulator function on its own (PubMed:20484466). Has no hormone-binding activity (PubMed:8621628). May play a role in controlling glucose metabolism by maintaining insulin sensitivity (By similarity). Reduces hepatic gluconeogenesis through down-regulation of PEPCK in an isoform Alpha-dependent manner (PubMed:26711253). Directly regulates STAT1 expression in isoform Alpha-independent manner (PubMed:26711253).Isoform Alpha-2: Has lower transcriptional activation activity than isoform Alpha. Exerts a dominant negative effect on isoform Alpha trans-repression mechanism (PubMed:20484466).Isoform GR-P: Increases activity of isoform Alpha.
Precision : Intra-assay Precision (Precision within an assay) CV%<15% Three samples of known concentration were tested twenty times on one plate to assess. Inter-assay Precision (Precision between assays) CV%<15% Three samples of known concentration were tested in twenty assays to assess.
Linearity : To assess the linearity of the assay, samples were spiked with hig3h concentrations of rat ADP in various matrices and diluted with the Sample Diluent to produce samples with values within the dynamic range of the assay.
Recovery :
Typical Data : These standard curves are provided for demonstration only. A standard curve should be generated for each set of samples assayed. ng/ml OD1 OD2 Average 1000 0.088 0.090 0.089 500 0.135 0.142 0.139 250 0.227 0.237 0.232 125 0.324 0.341 0.333 62.5 0.583 0.598 0.591 31.25 0.847 0.864 0.856 15.62 1.228 1.235 1.232 0 2.155 2.199 2.177
https://www.glorybios.com/product/28194/