Description
The kit is for the quantitative level of SEW in the sample, adopt purified Human SEW to coat microtiter plate, make solid-phase antibody, then add SEW to wells, Combine SEW antibody with labeled HRP to form antibody-antigen -enzyme-antibody complex, after washing completely, add TMB substrate solution, TMB substrate becomes blue color at HRP enzyme-catalyzed, reaction is terminated by the addition of a stop solution and the color change is measured at a wavelength of 450 nm. The concentration of SEW in the samples is then determined by comparing the O.D. of the samples to the standard curve.
Reactivity : Human
Method type : Sandwich ELISA
Minimum Detection Limit :1pg/ml
Detection Range :2pg/ml-90pg/ml
Application : ELISA
Purpose : For the quantitative determination of target substances concentrations.
Research Area : Immunology->Innate Immunity->Complement->Alternative Pathway, Immunology->Innate Immunity->Complement->Other
Sample Type : serum, plasma, Urine, tissue samples, cell culture supernates
Plate : Pre-coated,Strips (12 x 8)
Restrictions : For Research Use only
Storage : 2 °C - 8 °C
Storage Comment : Store at 4°C for 6 months, at -20°C for 12 months. Avoid multiple freeze-thaw cycles
Expiry Date : 12 months
Size : 96T
UniProt Number: P63302
Abbreviation:
MALAVRVVYCGAUGYKSKYLQLKKKLEDEFPGRLDICGEGTPQATGFFEVMVAGKLIHSK KKGDGYVDTESKFLKLVAAIKAALAQG
Availability : 3-5 working days
Target Details :Plays a role as a glutathione (GSH)-dependent antioxidant. May be involved in a redox-related process. May play a role in the myopathies of selenium deficiency (By similarity).
Precision : Intra-assay Precision (Precision within an assay) CV%<15% Three samples of known concentration were tested twenty times on one plate to assess. Inter-assay Precision (Precision between assays) CV%<15% Three samples of known concentration were tested in twenty assays to assess.
Linearity : To assess the linearity of the assay, samples were spiked with hig3h concentrations of rat ADP in various matrices and diluted with the Sample Diluent to produce samples with values within the dynamic range of the assay.
Recovery :
Typical Data : These standard curves are provided for demonstration only. A standard curve should be generated for each set of samples assayed. ng/ml OD1 OD2 Average 1000 0.088 0.090 0.089 500 0.135 0.142 0.139 250 0.227 0.237 0.232 125 0.324 0.341 0.333 62.5 0.583 0.598 0.591 31.25 0.847 0.864 0.856 15.62 1.228 1.235 1.232 0 2.155 2.199 2.177