Description

The kit takes out from the refrigeration should be balanced 15-30 minutes in the room temperature, if the coated ELISA plates have not been used up after opening, the plate should be stored in sealed bag.
Washing buffer will Crystallization separation, it can be heated the water helps dissolve when dilution. Washing does not affect the result.
Pipette sample with pipettors each step, and proofread its accuracy frequently, avoids the experimental error. Pipette sample within 5 min, if the number of sample is much, recommend using multichannel pipettor.
If the testing material content is excessively high (The sample OD is higher than the first standard well)?please dilute sample (n-fold).
Adhesive Strip only limits the disposable use to avoid cross-contamination.
The substrate should be preserved evade the light.
Please refer to use instruction strictly. The test result determination must take the microtiter plate reader as a standard.
All samples, washing buffer and each kind of reject should refer to infective material process.
Do not mix reagents with those from other lots.

Reactivity : Rat

Method type : Sandwich ELISA

Minimum Detection Limit :

Detection Range :

Application : ELISA

Purpose : For the quantitative determination of target substances concentrations.

Research Area : Tags & Cell Markers->Cell Type Markers->Tumor Associated, Signal Transduction->Cytoskeleton / ECM->Cell Adhesion->Cell Adhesion Molecules->Vascular, Signal Transduction->Cytoskeleton / ECM->Cell Adhesion->Cell Adhesion Molecules->Endothelial, Neuroscience->Neurology process->Neural Signal Transduction, Stem Cells->Mesenchymal Stem Cells->Surface Molecules, Cancer->Invasion/microenvironment->ECM->Cell adhesion->Other, Cardiovascular->Atherosclerosis->Vascular Inflammation->Leukocyte recruitment->Cell adhesion molecules, Kits/ Lysates/ Other->Kits->ELISA Kits->ELISA Kits->Adhesion molecules ELISA kits, Kits/ Lysates/ Other->Kits->ELISA Kits->ELISA Kits->Atherosclerotic proteins ELISA kits, Cardiovascular->Angiogenesis->Endothelial Cell Markers

Sample Type : serum, plasma, Urine, tissue samples, cell culture supernates

Plate : Pre-coated,Strips (12 x 8)

Restrictions : For Research Use only

Storage : 2 °C - 8 °C

Storage Comment : Store at 4°C for 6 months, at -20°C for 12 months. Avoid multiple freeze-thaw cycles

Expiry Date : 12 months

Size : 96T

Uniprot No. :P06211

Abbreviation :

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKMPMERALGEVYVDNSKPAVFNYPEGAAY
EFNAAAAAAAAGASAPVYGQSSITYGPGSEAAAFGANSLGAFPQLNSVSPSPLMLLHPPP
HVSPFLHPHGHQVPYYLENEPSAYAVRDTGPPAFYRSNSDNRRQNGRERLSSSSEKGNMI
MESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRK
SCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDLEGRNEMGTSGDMRAANLWPSP
LVIKHTKKNSPALSLTADQMVSALLDAEPPLIYSEYDPSRPFSEASMMGLLTNLADRELV
HMINWAKRVPGFGDLNLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQG
KCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHI
HRVLDKINDTLIHLMAKAGLTLQQQHRRLAQLLLILSHIRHMSNKGMEHLYNMKCKNVVP
LYDLLLEMLDAHRLHAPASRMGVPPEEPSQSQLTTTSSTSAHSLQTYYIPPEAEGFPNTI

Availability : 3-5 working days

Target Details :Nuclear hormone receptor. The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Ligand-dependent nuclear transactivation involves either direct homodimer binding to a palindromic estrogen response element (ERE) sequence or association with other DNA-binding transcription factors, such as AP-1/c-Jun, c-Fos, ATF-2, Sp1 and Sp3, to mediate ERE-independent signaling. Ligand binding induces a conformational change allowing subsequent or combinatorial association with multiprotein coactivator complexes through LXXLL motifs of their respective components. Mutual transrepression occurs between the estrogen receptor (ER) and NF-kappa-B in a cell-type specific manner. Decreases NF-kappa-B DNA-binding activity and inhibits NF-kappa-B-mediated transcription from the IL6 promoter and displace RELA/p65 and associated coregulators from the promoter. Recruited to the NF-kappa-B response element of the CCL2 and IL8 promoters and can displace CREBBP. Present with NF-kappa-B components RELA/p65 and NFKB1/p50 on ERE sequences. Can also act synergistically with NF-kappa-B to activate transcription involving respective recruitment adjacent response elements; the function involves CREBBP. Can activate the transcriptional activity of TFF1. Also mediates membrane-initiated estrogen signaling involving various kinase cascades. Essential for MTA1-mediated transcriptional regulation of BRCA1 and BCAS3 (By similarity).

Precision : Intra-assay Precision (Precision within an assay) CV%<15%   Three samples of known concentration were tested twenty times on one plate to assess.   Inter-assay Precision (Precision between assays) CV%<15%   Three samples of known concentration were tested in twenty assays to assess.

Linearity : To assess the linearity of the assay, samples were spiked with hig3h concentrations of rat ADP in various matrices and diluted with the Sample Diluent to produce samples with values within the dynamic range of the assay.

Recovery :

Typical Data : These standard curves are provided for demonstration only. A standard curve should be generated for each set of samples assayed. ng/ml OD1 OD2 Average     1000 0.088 0.090 0.089     500 0.135 0.142 0.139     250 0.227 0.237 0.232     125 0.324 0.341 0.333     62.5 0.583 0.598 0.591     31.25 0.847 0.864 0.856     15.62 1.228 1.235 1.232     0 2.155 2.199 2.177